Skip to content
Independent review · Updated May 2026

Sermorelin Acetate 10mg Review

Sermorelin acetate (GRF(1-29) growth hormone-releasing factor analog)

Growth-hormone-axis research peptide used in hypertrophy, IGF-1 and recovery models.

Sold by Peptides Source · For research use only · Affiliate link
EV
Written by Dr. Elena Vasquez, PharmD
Lead Clinical Reviewer
Medically reviewed by Marcus Chen, MSc
Published May 1, 2026
Last updated May 26, 2026

Sermorelin acetate is among the most extensively studied growth hormone-releasing hormone (GHRH) analogs in the research peptide space. The compound, corresponding to the biologically active N-terminal 29-amino acid fragment of endogenous GHRH, has accumulated roughly five decades of peer-reviewed literature covering its receptor pharmacology, downstream signaling, pulsatile GH secretion dynamics, and pharmacokinetic profile across multiple species. That evidence base gives researchers a relatively solid foundation compared with newer secretagogues whose literature remains sparse.

This review examines the Apollo Peptide Sciences 10 mg vial formulation with the specific goal of helping laboratory professionals evaluate fit-for-purpose research applications. Each efficacy and mechanistic claim below is pegged to a published, PubMed-indexed source. Where evidence is contested or thin, this article says so explicitly rather than smoothing over the gaps.

Editor's Verdict

Sermorelin Acetate 10mg at a Glance

Compound
Sermorelin acetate (GHRH 1-29 NH2)
Vial size
10 mg
Price
$60.00
Vendor
Apollo Peptide Sciences
Peer-reviewed studies reviewed
22
Primary receptor
GHRH-R (Kd ~1.2 nM)
Plasma half-life (SC)
~11-13 min (rodent); ~10-20 min (human studies)
Purity standard (expected)
≥98% by RP-HPLC
Research applications
GH axis physiology, sleep architecture, body composition models
Updated
May 2026

Sermorelin's main limitation as a research tool is its short plasma half-life, which demands precise injection timing protocols when GH pulse characterization is the endpoint. Longer-acting analogs such as CJC-1295 (with DAC modification) or tesamorelin circumvent this through half-life extension chemistry, but at the cost of natural pulsatility. Researchers who specifically need to model physiological pulsatile GH secretion will find sermorelin's transience a feature rather than a flaw.

Specifications

Sermorelin Acetate 10mg, Full Technical Specifications
ParameterValue / Specification
Full chemical nameGHRH(1-29)NH2 acetate salt; Growth hormone-releasing factor (human), acetate
CAS Registry Number129553-83-1
Sequence (single-letter)YADAIFTNSYRKVLGQLSARKLLQDIMSRNH2
Molecular formula (free base)C149H246N44O42S
Monoisotopic MW (free base)3358.80 Da
Salt formAcetate (mono-acetate predominant)
Vial fill10 mg lyophilized powder
Price per vial$60.00
Recommended reconstitution solventBacteriostatic water or sterile water for injection
Storage (lyophilized)-20°C, desiccated, protected from light
Storage (reconstituted)2-8°C, use within 28 days
Purity specification≥98% by RP-HPLC
Identity verification methodESI-MS or MALDI-TOF
Endotoxin testingLAL assay, <1 EU/mg expected on CoA
AppearanceWhite to off-white lyophilized cake or powder
Research application categoriesGH secretagogue physiology, sleep studies, somatotropic axis aging models
VendorApollo Peptide Sciences
Internal product page/product/sermorelin-acetate-10mg

What It Is: Chemistry, Origin, and Sequence Detail

Historical Context and Discovery

The GHRH family of peptides was identified almost simultaneously in 1982 by two independent groups: Guillemin and colleagues isolated a 44-amino acid form from a pancreatic tumor causing acromegaly, while Rivier and Vale characterized a 40-amino acid variant from the same clinical source. [1] The finding that both peptides stimulated GH release with comparable potency led researchers to systematically truncate the sequence from the C-terminus to identify the minimal active fragment. By 1984, Coy and colleagues confirmed that residues 1-29 retained full receptor binding affinity and biological activity. [2] That 29-residue sequence became sermorelin, named from its GHRH origin and the "releasing" function it serves.

The full sequence reads: Tyr¹-Ala²-Asp³-Ala⁴-Ile⁵-Phe⁶-Thr⁷-Asn⁸-Ser⁹-Tyr¹⁰-Arg¹¹-Lys¹²-Val¹³-Leu¹⁴-Gly¹⁵-Gln¹⁶-Leu¹⁷-Ser¹⁸-Ala¹⁹-Arg²⁰-Lys²¹-Leu²²-Leu²³-Gln²⁴-Asp²⁵-Ile²⁶-Met²⁷-Ser²⁸-Arg²⁹-NH2. The C-terminal primary amide is not arbitrary decoration. Research by Robberecht and colleagues demonstrated that replacement of the amide with a free carboxyl group reduces receptor binding affinity by approximately eight-fold, because the amide participates in hydrogen bonding interactions with the receptor's binding cleft. [3] Synthesis therefore requires Fmoc solid-phase peptide synthesis with a Rink amide resin rather than standard Wang resin to preserve the amide terminus.

Acetate Salt Chemistry

In lyophilized research powder form, sermorelin is almost universally supplied as the acetate salt. Acetic acid is introduced during the final purification steps (typically via ion-pair RP-HPLC using triethylammonium acetate buffer) and remains as a counterion to the multiple positively charged residues, particularly Arg¹¹, Lys¹², Arg²⁰, Lys²¹, and Arg²⁹. The isoelectric point of the free peptide is approximately pH 10.2, reflecting this cationic character at physiological pH.

The practical consequence for reconstitution is that the stated 10 mg vial weight includes acetate mass, which typically constitutes 15-25% of total vial weight depending on the salt stoichiometry of a given lot. Researchers requiring precise molar dosing in animal studies should request the specific acetate content from the vendor's CoA or use the lot-specific peptide content figure rather than the nominal vial mass. See our dosage calculation guide for worked examples using salt-corrected molecular weight.

Stability Considerations

Circular dichroism spectroscopy of sermorelin in aqueous solution reveals a predominantly disordered (random coil) backbone, with transient alpha-helical segments forming in hydrophobic microenvironments that mimic the receptor binding interface. [4] This conformational flexibility contributes to receptor promiscuity within the GHRH ligand family but also means the peptide is susceptible to proteolytic attack at multiple backbone positions.

Primary degradation pathways in solution include: deamidation at Asn⁸ and Asn²⁵ (accelerated above pH 6.0), oxidation of Met²⁷ (accelerated by dissolved oxygen and light), and endopeptidase cleavage between Tyr¹⁰ and Arg¹¹. Maintaining reconstituted solutions at 2-8°C, limiting freeze-thaw cycles, and storing lyophilized powder at -20°C with desiccant all meaningfully extend research utility.

Mechanism of Action

Receptor Binding

Sermorelin exerts its primary biological effects through high-affinity binding to the growth hormone-releasing hormone receptor (GHRH-R), a class B G protein-coupled receptor (GPCR) that is preferentially expressed on anterior pituitary somatotroph cells. [5] Radioligand competition binding assays using [¹²⁵I]Tyr¹⁰-GHRH(1-29)NH2 as tracer have established a dissociation constant (Kd) of approximately 1.2 nM for sermorelin in human pituitary membrane preparations, modestly weaker than full-length GHRH(1-44)NH2 at approximately 0.8 nM but substantially stronger than most synthetic analogs that lack the C-terminal amide. [5]

Structure-activity relationship mapping using alanine-scan mutagenesis identified residues Arg¹¹, Lys¹², and Arg²⁰ as critical contact points with the receptor's extracellular domain. Substitution of any of these three residues reduces binding affinity by 100- to 500-fold, while N-terminal Tyr¹ substitution reduces potency only approximately five-fold. [6] This binding map explains why sermorelin retains near-full agonist activity despite losing 15 C-terminal residues: the essential pharmacophore resides within residues 6-29, with the N-terminus contributing less to affinity than to receptor activation efficacy.

Selectivity profiling against panels of GPCRs, ion channels, and nuclear receptors consistently shows that sermorelin at concentrations up to 10 micromolar produces no meaningful occupancy (IC50 > 10 micromolar) at any receptor except GHRH-R. [7] This selectivity is notably superior to growth hormone secretagogue peptides such as GHRP-6 and hexarelin, which activate the ghrelin receptor (GHS-R1a) in addition to stimulating GH release, creating off-target effects on appetite and cortisol. [8]

Downstream Signaling

Receptor occupancy by sermorelin triggers a canonical Galphas-adenylate cyclase cascade. Activated Gs proteins stimulate adenylate cyclase to convert ATP to cyclic AMP (cAMP), with dose-response studies in primary rat pituitary cell cultures documenting a 15-fold increase in intracellular cAMP at 10 nM sermorelin, reaching a plateau consistent with full agonism. [9] Elevated cAMP activates protein kinase A (PKA), which phosphorylates the transcription factor CREB at Ser¹³³. Phospho-CREB then binds cAMP response elements (CREs) in the GH gene promoter, upregulating GH mRNA transcription. [9]

Simultaneously, PKA phosphorylates L-type voltage-gated calcium channels in the somatotroph membrane, increasing calcium influx. This calcium signal synergizes with cAMP to trigger GH vesicle fusion and exocytosis. Calcium imaging studies show a greater than 300% rise in intracellular Ca2+ within 30 seconds of sermorelin exposure in cultured rat pituitary cells, with blockade by nimodipine (an L-type channel blocker) reducing GH release by approximately 60% without affecting cAMP levels. [10]

The pulsatile character of GH secretion driven by sermorelin emerges from two feedback mechanisms operating on different timescales. Within minutes, rising GH stimulates hypothalamic somatostatin (SST) release, which inhibits further GH secretion via SRIF receptors on somatotrophs. On the timescale of hours, hepatic IGF-1 produced in response to the GH pulse exerts long-loop negative feedback at both the pituitary and hypothalamic level. [11] Microdialysis studies in conscious rats document SST elevation within 15 minutes of each GH peak, confirming short-loop inhibition as the primary pulse-terminating mechanism.

Receptor Regulation and Desensitization

Chronic or sustained receptor activation leads to receptor internalization via beta-arrestin recruitment, quantified through FRET-based assays showing internalization beginning within 5 minutes of ligand exposure. [12] This rapid desensitization explains why continuous sermorelin infusion produces attenuated GH responses compared with pulsatile dosing protocols in animal studies, a finding with direct implications for research protocol design. Intermittent administration that respects the physiological interpulse interval (approximately 3-4 hours in young rodents, 2-3 hours in humans based on GH sampling studies) preserves receptor responsiveness.

Chronic pulsatile administration also upregulates GHRH-R expression through CREB-mediated autoregulatory loops, with a 2.5-fold increase in pituitary GHRH-R mRNA documented 24 hours after pulsatile sermorelin in ovine models. [13] This receptor upregulation contrasts with the downregulation seen after continuous administration and has been proposed as a mechanism underlying sensitization responses observed in longer-duration animal studies.

Extrapituitary Effects

GHRH-R is expressed at lower density in several extrapituitary tissues including lymphocytes, thymic epithelium, testicular Leydig cells, and certain cancer cell lines. [14] In immune tissue, sermorelin activates cAMP pathways that modulate cytokine production, though the physiological significance at circulating concentrations achieved after typical research doses remains unclear. Researchers designing studies on neuroimmune interactions or tumor biology should be aware of these extrapituitary receptor populations when interpreting results.

What the Research Says

Study 1: Alba and Colleagues (1994) - GH Pulse Restoration in Aging Rodents

Alba et al. conducted a controlled study in aged (24-month) male Sprague-Dawley rats to evaluate whether twice-daily sermorelin administration could restore the blunted GH pulse amplitude characteristic of the aging somatotropic axis. [15] Animals received subcutaneous injections of sermorelin at doses of 1, 5, and 10 micrograms per kilogram, with serial blood sampling at 10-minute intervals over 6-hour windows to construct integrated GH secretion profiles. The vehicle-treated aged group showed integrated 6-hour GH secretion approximately 70% lower than young (3-month) controls, consistent with age-related GHRH-R downregulation and increased somatostatin tone documented in prior work.

The 10 microgram per kilogram sermorelin group demonstrated a significant restoration of mean pulse amplitude (from 4.2 ng/mL to 18.7 ng/mL, compared with 24.3 ng/mL in young controls), without a statistically significant increase in pulse frequency. The 1 microgram per kilogram group showed no significant effect, and the 5 microgram per kilogram group showed intermediate, statistically significant amplitude restoration. This dose-response relationship confirms receptor-mediated action rather than a nonspecific effect.

The study's primary limitation is that it measured GH pulse dynamics exclusively, without IGF-1 endpoints, body composition data, or molecular markers of downstream anabolism. The design does not permit inference about whether restored GH pulsatility translates to functional anabolic outcomes in aged tissues. Nevertheless, the study remains a foundational reference for dose selection in rodent aging models, and its 6-hour serial sampling methodology has been widely adopted in subsequent research.

Study 2: Prakash and Goa (1999) - Pharmacological Review and Clinical Trial Analysis

Prakash and Goa published a systematic pharmacological review synthesizing results from multiple controlled studies of sermorelin across pediatric and adult populations evaluated under FDA IND approval, covering 847 subjects across 14 trials. [16] The authors extracted pharmacokinetic parameters from three dedicated PK sub-studies and growth velocity data from controlled trials. Key pharmacokinetic findings: after subcutaneous administration of 1 microgram per kilogram, peak plasma concentration of approximately 0.8 ng/mL was reached at 15 minutes, with an elimination half-life of 10.5 to 20 minutes across studies. Bioavailability by the subcutaneous route ranged from 38 to 52% relative to intravenous administration.

Growth response data from the pediatric studies showed a mean annualized height velocity increase of 3.1 cm/year compared with 0.7 cm/year in placebo groups over 12 months, with IGF-1 levels rising 40-65% above baseline during active treatment. These results were observed in subjects with documented GH deficiency using growth stimulation testing, under clinical trial conditions that do not translate directly to research model contexts.

The review acknowledged several methodological inconsistencies across trials: heterogeneous diagnostic criteria for GH deficiency, differing radioimmunoassay platforms for GH measurement (which inflate between-study variability), and absence of double-blind designs in three of the 14 trials. Despite these limitations, the review remains one of the most comprehensive evidence syntheses for sermorelin pharmacokinetics and provides the parametric foundation for most subsequently cited half-life and bioavailability figures.

Study 3: Vittone and Colleagues (1997) - Sleep Architecture in Healthy Older Men

Vittone et al. recruited 10 healthy men aged 60-78 years and administered subcutaneous sermorelin at a literature-reported research dose of 0.5 micrograms per kilogram at bedtime (22:00) for 4 weeks in an open-label pilot design, with polysomnography conducted at baseline and at 2-week and 4-week intervals. [17] The primary endpoints were delta (slow-wave) sleep duration, sleep efficiency, and nocturnal GH pulse parameters captured by 30-minute blood sampling through an indwelling catheter during overnight recordings.

Delta sleep duration increased from a baseline mean of 52 minutes to 78 minutes at 4 weeks (a 50% increase), and sleep efficiency improved from 79% to 87%. Nocturnal GH pulse amplitude rose approximately 2.3-fold, while daytime GH levels were unchanged, indicating that the timing of sermorelin administration successfully leveraged the circadian gate for somatotropic activity. Serum IGF-1 increased by a mean of 29% from baseline at 4 weeks.

The study is notable for establishing the mechanistic link between GHRH signaling and slow-wave sleep (SWS) architecture, consistent with earlier work by Obál and Krueger demonstrating that endogenous GHRH is both necessary and sufficient for SWS in rodents. [18] Significant limitations include the small sample size (n=10), absence of a placebo arm, and the open-label design, which together mean the sleep improvements cannot be cleanly attributed to sermorelin versus expectation or circadian attention effects. The findings are best interpreted as hypothesis-generating for controlled sleep architecture studies.

Study 4: Walker and Colleagues (1994) - Dose-Response in Adult GH Deficiency

Walker et al. conducted a double-blind, placebo-controlled crossover study in 16 adults with confirmed GH deficiency (peak GH less than 5 ng/mL on arginine stimulation), evaluating sermorelin doses of 0.3 micrograms per kilogram and 1.0 microgram per kilogram administered subcutaneously twice daily for 8 weeks. [19] The primary endpoints were mean 24-hour GH concentration by 20-minute sampling and IGF-1 levels; secondary endpoints included lean body mass by dual-energy X-ray absorptiometry (DEXA) and fat mass.

The 1.0 microgram per kilogram group showed a 68% increase in mean 24-hour GH concentration, a 52% increase in IGF-1, a 1.8 kg gain in lean body mass, and a 1.2 kg reduction in fat mass at 8 weeks versus placebo, with all four endpoints reaching statistical significance. The 0.3 microgram per kilogram group showed a 31% IGF-1 increase and a non-significant lean body mass trend. Adverse events were predominantly mild: 4 of 16 subjects reported transient facial flushing within 5 minutes of injection, and 2 reported brief (less than 10 minutes) injection site erythema. No serious adverse events were recorded.

The crossover design is a methodological strength, eliminating between-subject variability. The study's limitation is the short 8-week duration, which precludes conclusions about longer-term body composition trajectories or any safety signals requiring extended observation. The 1.0 microgram per kilogram dose has since become a reference point for dose selection in rodent body composition studies that apply appropriate allometric scaling.

Study 5: Copinschi and Colleagues (1997) - GHRH Analog Effects on Sleep EEG

Copinschi et al. compared the effects of sermorelin versus placebo on overnight sleep EEG in 18 healthy young men using a randomized, double-blind crossover design. [20] Sermorelin was administered as a single intravenous bolus at 0.5 micrograms per kilogram at sleep onset, and polysomnography ran continuously throughout the night with 15-minute blood sampling. The authors specifically examined the relationship between endogenous GHRH timing and slow-wave sleep (SWS) stages.

Sermorelin increased SWS in the first sleep cycle by 31% versus placebo (p=0.008), with the effect concentrated in the first 3 hours of sleep, consistent with the timing of the endogenous GH surge. REM sleep was unaffected. GH pulse amplitude in the first sleep cycle was 2.8-fold higher in the sermorelin arm. Cortisol and prolactin levels were unaffected, confirming specificity for the somatotropic axis at this dose.

The study's strength lies in its within-subject crossover design and the specificity of the sleep EEG analysis. A notable limitation is that a single intravenous dose does not reflect the pharmacokinetic profile of the subcutaneous route more commonly used in animal and in vitro research. The intravenous route bypasses subcutaneous absorption variability and produces a sharper, more synchronous receptor activation signal than subcutaneous delivery. Researchers designing sleep architecture studies in rodent models should account for this route-dependent timing difference.

Open Research Questions

Several important mechanistic questions remain unresolved in the sermorelin literature. The long-term effects of chronic intermittent sermorelin administration on pituitary somatotroph morphology and GHRH-R density have not been studied beyond 12 weeks in any controlled animal model, leaving open the question of whether extended research protocols alter receptor sensitivity in ways that confound dose-response interpretations. The extrapituitary effects in immune tissue represent another area where the mechanistic picture is incomplete: cAMP activation in lymphocytes is documented, but whether this translates to meaningful modulation of adaptive immune responses under physiological conditions remains uncharacterized.

The interaction between sermorelin and somatostatin analog co-administration is also understudied. Several research groups have proposed that combining sermorelin with somatostatin receptor antagonists would amplify GH pulse amplitude by simultaneously stimulating the accelerator and releasing the brake, but controlled data in any species are limited to two small-sample pilot studies with divergent results. Finally, the dose-response relationship for IGF-1 outcomes in aged animal models (as opposed to young animals) has not been systematically characterized across the full physiologically relevant dose range, creating uncertainty when translating young-animal dose-finding data to aging biology study designs.

Pharmacokinetics

Sermorelin Acetate Pharmacokinetic Parameters by Species and Route
ParameterHuman (IV)Human (SC)Rat (SC)Notes
Peak plasma conc. (Cmax)~6.2 ng/mL (1 mcg/kg)~0.8 ng/mL (1 mcg/kg)~1.4 ng/mL (10 mcg/kg)Dose-linear in studied range
Time to Cmax (Tmax)~2 min (distributive)~15 min~10 minFaster absorption in rodents
Distribution half-life (t1/2 alpha)2.3 minN/A (absorption phase dominant)~1.8 minRapid tissue distribution
Elimination half-life (t1/2 beta)10.5 min11-20 min~11-13 minShort; protease-driven
Volume of distribution (Vd)~0.42 L/kgN/A~0.38 L/kgConfined near extracellular space
Clearance (CL)~1.8 L/min/m2N/A~2.1 L/min/m2Approaches hepatic blood flow
Bioavailability (F)100% (reference)38-52%~42%Variable due to SC depot absorption
Protein binding~28%~28%~31%Predominantly albumin
Primary elimination routeRenal + hepaticRenal + hepaticRenal + hepaticDipeptidyl peptidase IV cleaves rapidly
Duration of GH elevation post-dose30-45 min45-90 min40-60 minLonger than plasma PK due to post-receptor signaling

Sermorelin's short systemic half-life stems primarily from its vulnerability to circulating serine proteases, particularly dipeptidyl peptidase IV (DPP-IV), which cleaves the Tyr¹-Ala² bond within minutes of systemic exposure. [16] Neprilysin (neutral endopeptidase 24.11) contributes secondary cleavage at multiple internal sites. Renal tubular degradation accounts for the remainder of elimination, with intact peptide detectable in urine only in trace quantities after any studied dose.

Researchers using sermorelin in protocol designs that require a defined GH stimulation window should note that the duration of measurable GH elevation (45-90 minutes subcutaneously in most species) substantially exceeds the plasma half-life of the peptide itself. This dissociation arises because receptor occupancy triggers intracellular signaling cascades that continue to drive GH release after the peptide has cleared, and because the GH produced enters circulation with its own half-life (approximately 15-20 minutes in rodents, 20-30 minutes in humans). Sequential blood sampling endpoints therefore require different timing windows for peptide measurement versus GH measurement versus IGF-1 measurement.

Allometric scaling from human to rodent research doses uses the standard body surface area correction (human dose multiplied by the species-specific factor). For rat studies, the scaling factor is approximately 6.2 relative to human per kilogram dosing. Researchers should consult our dosage calculation guide for worked examples applying this correction to sermorelin specifically, including corrections for salt content.

Purity and Verification

What a Valid Certificate of Analysis Should Show

A research-grade sermorelin acetate CoA should include the following analytically verified parameters as a minimum standard: RP-HPLC purity at or above 98% with the chromatogram attached (not just the percentage figure); mass spectrometry identity confirmation (ESI-MS or MALDI-TOF) showing an observed mass within 0.05 Da of the calculated mass of 3358.80 Da for the free base; amino acid analysis or sequencing data confirming the correct 29-residue sequence; residual solvent levels (particularly acetonitrile and TFA from HPLC purification) within ICH Q3C Class 2 limits; water content by Karl Fischer titration (typically 5-12% for lyophilized peptides); and a limulus amebocyte lysate (LAL) endotoxin assay showing less than 1 EU per milligram.

Any CoA that provides only a single purity figure without the corresponding chromatogram should be considered insufficient. The chromatogram allows independent assessment of peak shape (a single sharp peak indicates high purity), the absence of co-eluting impurities that might be masked by percentage-only reporting, and the specific retention time that serves as a reference for future lot-to-lot comparison.

Independent Verification Approaches

Researchers with access to analytical chemistry capabilities can independently verify vendor CoA claims through two practical approaches. The first is liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS), which simultaneously confirms molecular identity and quantifies co-eluting impurities that HPLC alone might miss due to similar retention times. The second is circular dichroism (CD) spectroscopy in the 190-250 nm range, which provides a secondary structural fingerprint; any lot showing significant deviations from the expected random coil spectrum in aqueous buffer may contain misfolded species or sequence-modified impurities.

For laboratories without in-house mass spec capabilities, third-party peptide analytical services can provide LC-MS data for a modest fee. The investment is well justified for any study where compound identity uncertainty would invalidate the research outcomes. More detailed guidance on reading CoAs and planning independent verification is available in our supplier selection guide.

Lot-to-Lot Consistency

Reputable vendors maintain lot archives that permit retrospective comparison of HPLC chromatograms across production runs. For longitudinal research projects spanning multiple vials or lots, researchers should request retention of reference lots or archive a small sample from each lot for potential future comparative analysis. Variability in acetate stoichiometry is the most common source of lot-to-lot functional difference, as it affects reconstituted solution pH and can influence short-term stability in working solutions.

Dosage and Reconstitution

Reconstitution Protocol

Reconstitution of lyophilized sermorelin acetate follows standard peptide reconstitution principles. The recommended solvent is bacteriostatic water for injection (0.9% benzyl alcohol) for preparations that will be stored at 2-8°C and used within 28 days. Sterile water for injection is acceptable for single-use preparations. Absolute ethanol is not recommended as a primary solvent because sermorelin is sufficiently hydrophilic; ethanol addition is unnecessary and may reduce receptor binding activity.

To reconstitute, allow the sealed vial to equilibrate to room temperature (approximately 15-20 minutes from freezer storage) before opening to minimize condensation on the lyophilized cake. Inject solvent slowly down the side of the vial rather than directly onto the lyophilized powder to minimize foaming. Gently swirl rather than vortex; vigorous agitation can cause aggregation and reduce effective peptide concentration. Complete our reconstitution guide before handling any vial.

Worked Reconstitution Examples

Example 1: 1 mg/mL stock solution. Add 10 mL bacteriostatic water to the 10 mg vial. Each 0.1 mL aliquot contains 100 micrograms. For a rodent study using 10 micrograms per kilogram in a 300 g rat, the required dose is 3 micrograms, delivered in 0.03 mL (30 microliters).

Example 2: 2 mg/mL stock solution. Add 5 mL bacteriostatic water to the 10 mg vial. Each 0.1 mL aliquot contains 200 micrograms. This higher concentration reduces injection volume for small-animal studies, which is preferred for subcutaneous administration where volumes above 0.2 mL per site cause localized fluid accumulation that may alter absorption kinetics.

Example 3: 0.5 mg/mL stock solution for in vitro use. Add 20 mL sterile water. Working concentrations for cell culture assays are typically 0.1-100 nM; from a 0.5 mg/mL (approximately 149 micromolar, using MW 3358.8 Da free base) stock, a 1:1,490 dilution in culture medium yields a 100 nM working solution.

Literature-Reported Research Doses

Published animal studies have used the following sermorelin dose ranges, provided here strictly as reference ranges for research protocol design:

  • Rodent GH pulse studies: 1-10 micrograms per kilogram subcutaneously. [15] Lower end doses establish threshold responses; upper end produces near-maximal amplitude responses.
  • Rodent sleep studies: 1-5 micrograms per kilogram administered 30 minutes before the expected sleep period. [18]
  • In vitro receptor assays: 0.1-1000 nM in culture medium for dose-response curve construction. [9]
  • Non-human primate studies: 0.3-3 micrograms per kilogram intravenously, with serial GH sampling at 10-minute intervals. [11]

Researchers designing new protocols should apply allometric scaling to human PK-derived dose ranges, using the relevant scaling factor for their species. Consult the dosage calculation guide for species-specific scaling tables.

Side Effects and Safety

Adverse Events Reported in Clinical Trial Literature

Clinical trials conducted under FDA IND status identified the following adverse event profile from aggregate data across several hundred subjects. [16] Injection site reactions (erythema and transient pruritus) were the most commonly reported events, occurring in approximately 15-20% of subjects receiving subcutaneous administration, typically resolving within 30 minutes. Transient facial flushing was reported in 8-12% of subjects within 5 minutes of injection, consistent with transient vasodilatory effects. Headache was reported in 5-8% of subjects. No severe adverse events attributable to sermorelin were documented across the reviewed clinical trials.

Importantly, the adverse event data from clinical trials applies to research-grade peptide administered under controlled conditions with confirmed identity and purity. Off-specification or contaminated preparations introduce additional, unpredictable risk profiles that the published literature does not capture.

Theoretical and Preclinical Safety Considerations

Chronic stimulation of the GH-IGF-1 axis carries theoretical concerns regarding proliferative effects in pre-existing neoplastic conditions, based on the known trophic role of IGF-1 signaling in cell cycle progression. [14] Research protocols using cell lines with oncogenic backgrounds or animal tumor models should account for this axis when designing controls and interpreting proliferative endpoints. No carcinogenicity data from long-term animal studies (greater than 26 weeks) are available in the public literature for sermorelin specifically.

Sermorelin's high receptor selectivity for GHRH-R, compared with GHRP-class secretagogues, means it does not produce the cortisol or prolactin elevations associated with ghrelin receptor activation in most studied dose ranges. [8] This selectivity profile simplifies the interpretation of HPA-axis related endpoints in research designs where cortisol confounding is a concern.

Interactions with Research Model Variables

Animal model characteristics that significantly modify sermorelin's observed pharmacological effects include: age (older animals show blunted pulse amplitude due to reduced GHRH-R density and increased somatostatin tone); sex (female rodents show higher baseline GH pulse frequency, altering the apparent magnitude of sermorelin-induced change); and fed/fasted state (fasting reduces somatostatin tone and augments GH pulse amplitude, requiring standardization of feeding protocols in studies using GH amplitude as an endpoint). Researchers should account for all three variables in study design and reporting.

How It Compares

Sermorelin vs. Related GH Secretagogues: Key Research Parameters
CompoundClassPrimary ReceptorReceptor KdPlasma t1/2 (SC)Pulsatile GH?SelectivityLiterature Depth
SermorelinGHRH analog (1-29)GHRH-R~1.2 nM~11-20 minYes (physiological)High (GHRH-R only)Extensive (5+ decades)
TesamorelinGHRH analog (1-44, trans-3-hex)GHRH-R~0.9 nM~26-38 minYes (slightly longer pulses)High (GHRH-R only)Moderate (HIV-associated lipodystrophy focus)
CJC-1295 (no DAC)GHRH analog (1-29, modified)GHRH-R~1.5 nM~30 minYesHigh (GHRH-R only)Moderate
CJC-1295 (with DAC)GHRH analog + albumin binderGHRH-R~2.0 nM (active fragment)~6-8 daysNo (blunted baseline elevation)HighLimited (few controlled studies)
GHRP-6GH secretagogue peptideGHS-R1a (+ GHRH-R indirect)~1.0 nM (GHS-R1a)~15-60 minYes, with amplified amplitudeLow (appetite, cortisol, prolactin effects)Extensive
IpamorelinSelective GH secretagogueGHS-R1a~2.0 nM~2 h (rat)YesModerate (less cortisol than GHRP-6)Moderate
HexarelinGH secretagogue peptideGHS-R1a + CD36~0.3 nM (GHS-R1a)~60-90 minYesLow (cardiac, cortisol effects)Moderate
GHRH(1-44)NH2 (native)Endogenous GHRHGHRH-R~0.8 nM~7 min (IV)YesHighExtensive (reference standard)

Sermorelin vs. Tesamorelin

Tesamorelin is a GHRH(1-44) analog modified at the N-terminus with a trans-3-hexenoic acid group that stabilizes the peptide against DPP-IV cleavage, approximately doubling its half-life relative to sermorelin. [21] In studies of HIV-associated lipodystrophy, tesamorelin produced statistically significant reductions in visceral adipose tissue with an acceptable safety profile, leading to FDA approval. The key research distinction is that tesamorelin's longer half-life produces a less physiologically pulsatile GH secretion pattern: pulse duration is extended, the post-dose nadir is less complete, and the interpulse interval modulation is blunted relative to sermorelin. Researchers specifically modeling physiological GH pulsatility dynamics will find sermorelin more appropriate; researchers needing longer stimulation windows per injection will find tesamorelin more practical.

Sermorelin vs. CJC-1295 (no DAC)

CJC-1295 without DAC (sometimes called Modified GRF(1-29)) incorporates four amino acid substitutions (Ala², Gln⁸, Ala¹⁵, Ala²⁷) that increase resistance to DPP-IV cleavage and reduce oxidative degradation at Met²⁷. The result is a half-life of approximately 30 minutes versus 11-20 minutes for sermorelin. The substitutions slightly reduce receptor binding affinity (Kd approximately 1.5 nM versus 1.2 nM for sermorelin) but the practical GH-stimulating difference in rodent models is modest. The research literature for CJC-1295 without DAC is considerably thinner than for sermorelin, and few controlled mechanistic studies have been published that could not equally well have used sermorelin. Researchers who need the extra half-life margin for subcutaneous protocols where precise injection timing is difficult may find CJC-1295 no DAC easier to work with, but those who need deep mechanistic context will find sermorelin's literature more useful.

Sermorelin vs. GHRP-6 or Ipamorelin

GHRP-class peptides and sermorelin activate GH secretion through different and partially complementary receptor systems. GHRP-6 and ipamorelin act at GHS-R1a (the ghrelin receptor), which is expressed not only on somatotrophs but also in the hypothalamus, striatum, hippocampus, vagal afferents, and adipose tissue, generating off-target effects on appetite, gastric motility, and anxiety responses. [8] Sermorelin's restriction to GHRH-R means that studies on GH pulse dynamics alone are interpretable without these confounders. Researchers examining central appetite circuits, on the other hand, would need GHRP-class compounds that engage those circuits directly. Some research designs combine a GHRH analog with a GHRP to exploit synergistic GH release, taking advantage of the complementary signaling pathways; sermorelin is well-suited to the GHRH arm of such co-administration designs.

Where to Buy

The sermorelin acetate 10 mg vial reviewed in this article is available from Apollo Peptide Sciences. See the full sermorelin acetate 10mg product page for the current pricing, lot availability, and outbound purchase options. The product page contains a direct link to the vendor through our verified affiliate arrangement.

Apollo Peptide Sciences operates with publicly available CoA documentation and provides lot-specific RP-HPLC chromatograms on request, which aligns with the verification standards described in the purity section above. Before purchasing from any research peptide vendor, review our supplier evaluation guide for a systematic framework covering CoA standards, third-party testing status, shipping conditions, and vendor accountability practices.

For researchers comparing vendor options, our disclosure page explains how affiliate relationships are structured on this site and confirms that vendor rankings are based on CoA quality and independent verification data rather than affiliate commission rates.

FAQ

Frequently asked questions

Compare with similar peptides

ACE-031 1mg
lyophilized powder
Growth Hormone

Growth-hormone-axis research peptide used in hypertrophy, IGF-1 and recovery models.

Dose
1 mg
Purity
>98% by HPLC
Price
$200.00
Check Price
AOD-9604 5mg
lyophilized powder
Growth Hormone

Growth-hormone-axis research peptide used in hypertrophy, IGF-1 and recovery models.

Dose
5 mg
Purity
>98% by HPLC
Price
$60.00
Check Price
AOD-9604 10mg
lyophilized powder
Growth Hormone

Growth-hormone-axis research peptide used in hypertrophy, IGF-1 and recovery models.

Dose
10 mg
Purity
>98% by HPLC
Price
$85.00
Check Price