LL-37 5mg Review

LL-37 occupies a singular position in the antimicrobial peptide literature: it is the only cathelicidin family member identified in humans, and its biology extends well beyond classical membrane disruption into immunomodulation, angiogenesis, wound repair, and antiviral defense. Because of this functional breadth, LL-37 has attracted sustained research interest across infectious disease, dermatology, gastroenterology, and oncology.

Apollo Peptide Sciences supplies LL-37 as lyophilized powder in 5 mg vials at $45.00, a specification that suits both small-scale in-vitro assays and moderate-size animal-model experiments. This review evaluates the compound's chemistry, published pharmacology, purity standards, and research handling requirements in depth, drawing on primary peer-reviewed literature throughout.

Editor's Verdict

The compound's multifunctionality is simultaneously its greatest scientific asset and its most significant interpretive challenge. Dose-response relationships are non-linear in several cell systems, and context-dependent pro- versus anti-inflammatory behavior means that experimental design requires careful attention to concentration range, cell type, and co-stimulatory environment. The evidence base is strongest for antimicrobial and wound-healing endpoints; evidence for gut-health applications is growing but remains largely preclinical.

Specifications

What It Is, Chemistry, Origin, and Sequence Detail

Biological origin and gene context

LL-37 is the C-terminal cleavage fragment of hCAP-18, a precursor protein encoded by the CAMP gene on chromosome 3p21.3. ^[1] hCAP-18 belongs to the cathelicidin superfamily, a class of proteins unified by a conserved N-terminal cathelin domain and a hypervariable C-terminal antimicrobial domain. In humans, CAMP is the only cathelicidin gene, making LL-37 the sole endogenous cathelicidin; rodents, in contrast, carry multiple cathelicidin genes, a fact that complicates direct cross-species extrapolation. ^[2]

The active peptide is released post-translationally. Proteinase 3, a serine protease stored in azurophilic granules of neutrophils, cleaves the signal peptide, the cathelin prodomain, and then the hCAP-18 precursor at the N-terminal side of the first leucine residue, yielding the mature 37-residue LL-37 fragment. ^[1] This proteolytic activation mechanism means that LL-37 expression and activity are tightly coupled to neutrophil degranulation and inflammatory activation, an important context for interpreting in-vitro studies that use exogenously added synthetic peptide.

LL-37 is expressed not only in neutrophils but also in epithelial cells of the skin, lung, gut, and genitourinary tract, as well as in monocytes, NK cells, and mast cells. ^[3] Tissue expression can be upregulated by bacterial components, pro-inflammatory cytokines (TNF-alpha, IL-1beta), vitamin D receptor activation, and short-chain fatty acids produced by commensal microbiota, situating the peptide at the interface of innate immunity, microbiome interactions, and epithelial physiology. ^[4]

Primary sequence and amphipathic architecture

The full sequence [LL-37, 37 aa] contains 37 residues with an empirically confirmed molecular weight of approximately 4493 Da and molecular formula C₂₀₅H₃₄₀N₆₀O₅₃. ^[2] Of the 37 residues, 16 are charged at physiological pH, yielding the net +6 charge that underpins electrostatic attraction to negatively charged bacterial membranes. The sequence encodes a "helix-break-helix" architecture; a hydrophobic cluster involving Ile13, Phe17, and Ile20 forms one face of the amphipathic helix while basic residues (Lys, Arg) occupy the opposing face. ^[5]

In aqueous solution at low concentration, LL-37 exists as a largely unstructured random coil. Upon encountering lipid bilayers, micelles, or membrane-mimetic solvents such as trifluoroethanol, the peptide undergoes a conformational switch to a stable alpha-helix, as confirmed by circular dichroism spectroscopy and polarized attenuated total reflectance Fourier-transform infrared spectroscopy. ^[1] This conformation-switching behavior is mechanistically important: the peptide is essentially "activated" by membrane contact, limiting off-target interactions in the aqueous phase.

Post-translational modifications in physiological contexts

Native LL-37 is subject to several enzymatic and non-enzymatic modifications that modulate its activity. Carbamylation of lysine residues by physiological concentrations of cyanate has been documented by mass spectrometry; modification occurs sequentially at Lys-8, Lys-12, and Lys-15, generating LL37C8 and LL37C12,15 variants. ^[4] Because LL-37's cationic character depends on its lysine and arginine residues, carbamylation reduces net positive charge and attenuates both bactericidal and LPS-neutralizing activity.

Citrullination by peptidyl-arginine deiminases (PADs) represents a second modification pathway. Substitution of arginine by citrulline (neutral) progressively diminishes the peptide's ability to form complexes with self-DNA and to activate plasmacytoid dendritic cells (pDCs), a critical pathway in the immunopathogenesis of lupus and psoriasis. ^[6] For research teams using LL-37 in immunological assays, these endogenous modification pathways provide important experimental controls: comparing native LL-37 against carbamylated or citrullinated analogs can reveal which biological effects depend on cationic character versus structural conformation.

Synthetic analogs and truncated fragments in research

Because full-length LL-37 exhibits dose-dependent cytotoxicity and rapid proteolytic degradation in biological fluids, much contemporary research employs truncated or modified fragments. ^[5] Fragments such as GF-17 (residues 17-32), FK-16 (residues 17-32 with alternate numbering), FK-13, KR-12, and RI-10 retain core antimicrobial activity at lower hemolytic thresholds. Retro-analogs with reversed sequences and D-amino acid substitutions enhance proteolytic stability while preserving amphipathic character. ^[5] The 5 mg vials reviewed here contain full-length native-sequence LL-37; researchers interested in analog comparisons should consult the relevant structure-function literature before designing experiments.

Mechanism of Action

Membrane disruption and the carpet model

The primary antimicrobial mechanism of LL-37 is physical disruption of microbial membranes. The peptide's cationic surface creates an initial electrostatic attraction to the anionic outer leaflet of bacterial membranes (comprised of phosphatidylglycerol, cardiolipin, and lipopolysaccharide in Gram-negative; teichoic acids and phosphatidylglycerol in Gram-positive organisms). ^[7] Subsequent hydrophobic insertion of the helical face into the bilayer destabilizes membrane integrity through a "carpet-like" mechanism rather than the discrete transmembrane barrel-stave pores associated with some defensins. In the carpet model, peptides accumulate on the membrane surface at sub-threshold concentrations until a critical surface density is reached, at which point the bilayer collapses in a detergent-like manner, releasing cytoplasmic contents. ^[1]

Crucially, LL-37 does not form stable transmembrane pores in zwitterionic eukaryotic membranes under physiological conditions, as demonstrated by oriented circular dichroism and neutron diffraction studies showing that the peptide lies approximately parallel to the bilayer surface rather than inserting perpendicularly. ^[1] This orientation difference between prokaryotic and eukaryotic membranes provides a partial selectivity window, though this window narrows at higher concentrations, explaining the cytotoxicity observed in vitro above approximately 5-10 microM.

Beyond membrane disruption, LL-37 can translocate across bacterial membranes to interact with intracellular targets including acyl carrier proteins and nucleic acids, potentially contributing to bactericidal activity at sub-lethal membrane-disrupting concentrations. ^[7]

FPR2 receptor binding and downstream signaling

On host immune cells, LL-37 signals primarily through formyl peptide receptor 2 (FPR2, formerly FPRL1), a Galphai-coupled seven-transmembrane receptor. ^[8] Binding of LL-37 to FPR2 on neutrophils and monocytes triggers intracellular Ca²+ mobilization, chemotaxis, and superoxide production, as demonstrated by pertussis toxin-sensitive signaling assays and FPR2-knockout controls. ^[8] T lymphocytes expressing FPR2 similarly migrate toward LL-37 gradients, establishing the peptide as a chemoattractant that recruits adaptive immune cells to sites of infection or injury.

In endothelial cells, FPR2 activation by LL-37 initiates a PI3K/AKT/mTOR signaling cascade that upregulates vascular endothelial growth factor A (VEGFA), promoting endothelial proliferation, directed migration, and capillary tube formation. ^[9] This angiogenic signaling pathway has been confirmed in chorioallantoic membrane assays and rabbit hind-limb ischemia models, where LL-37 administration at research doses resulted in measurable neovascularization that was blocked by FPR2 antagonists. ^[3]

P2X7 receptor modulation

A distinct receptor interaction involves the P2X7 ligand-gated ion channel, expressed on macrophages, microglia, and epithelial cells. ^[10] LL-37 modulates P2X7 receptor activity in a structure-dependent manner: growth-promoting effects of LL-37 require P2X7 expression, as shown by inhibition with pharmacological P2X7 blockers, loss of activity in P2X7-deficient cells, and rescue following P2X7 transfection. Notably, the all-D enantiomer of LL-37 retains P2X7-dependent activity while scrambled analogs do not, indicating that specific three-dimensional amphipathic structure rather than stereospecific receptor-residue contact drives this interaction. ^[10]

P2X7 activation by LL-37 triggers IL-1beta processing and NLRP3 inflammasome assembly in macrophages, contributing to pro-inflammatory signaling at sites of infection. This adds a layer of complexity to the interpretation of LL-37's immunological effects: the peptide can simultaneously attract and activate immune cells (via FPR2 and P2X7) while also exerting direct anti-inflammatory effects through LPS neutralization and TLR4 signaling suppression.

LPS neutralization and anti-endotoxin activity

LL-37 binds bacterial lipopolysaccharide (LPS) with high affinity through electrostatic and hydrophobic interactions, effectively sequestering LPS from LPS-binding protein (LBP) and CD14, and thereby blocking downstream TLR4/MD-2 complex activation. ^[11] Surface plasmon resonance and fluorescence displacement assays have characterized three parallel anti-endotoxin mechanisms: direct LPS binding that precludes LBP transfer to CD14; direct binding to CD14 that competes with LPS; and disruption of LPS micelles or aggregates into monomers that bind poorly to the LPS recognition complex. The net result is reduced NF-kappaB activation and attenuated cytokine production (TNF-alpha, IL-6, IL-8) in LPS-stimulated monocytes and macrophages.

Wound healing, epithelial repair, and gut-health signaling

In epithelial tissues, LL-37 promotes repair through multiple convergent pathways. EGFR transactivation by LL-37 stimulates keratinocyte and intestinal epithelial cell migration and proliferation, providing a direct mucosal-repair signal. ^[3] In intestinal epithelial cell lines, LL-37 has been shown to increase tight-junction protein expression, reduce paracellular permeability, and counteract apoptosis induced by enteric pathogens, effects relevant to the "gut-health" research category. ^[12] The peptide also stimulates release of connective tissue growth factor (CTGF) and fibroblast growth factor-2 (FGF-2) from stromal cells, augmenting extracellular matrix deposition and the late phases of cutaneous wound healing.

What the Research Says

Study 1, Angiogenic activity via FPR2 (Koczulla et al., 2003)

Koczulla and colleagues conducted one of the first systematic investigations into LL-37's angiogenic properties, using three complementary model systems: an in-vitro tube formation assay with human umbilical vein endothelial cells (HUVECs), an ex-vivo chorioallantoic membrane (CAM) assay, and an in-vivo rabbit corneal micropocket assay. ^[3] In the HUVEC model, LL-37 at concentrations from 0.1 to 1 microM significantly increased tube length and branching versus vehicle control; the effect was abolished by a specific FPR2 antagonist and replicated by an FPR2 agonist peptide, confirming receptor specificity.

In the CAM assay, LL-37 at 5 micrograms per pellet induced visible neovascularization within 72 hours, comparable in magnitude to VEGF-positive controls at the same mass dose. The rabbit corneal model, considered the most rigorous in-vivo angiogenesis assay available at the time, demonstrated dose-dependent sprouting from the limbal vasculature following LL-37 implantation. Neovascularization was quantified by digital image analysis of corneal sections, and histological examination confirmed the presence of CD31-positive endothelial cells in newly formed vessels.

The study's main limitation is the absence of a mechanistic dissection of the downstream signaling pathway beyond FPR2 identification; the PI3K/AKT/mTOR cascade was characterized by subsequent work. The clinical relevance is significant for wound-healing research: localized production of LL-37 at injury sites may contribute to the vascularization phase of tissue repair independently of exogenous VEGF.

Study 2, Antimicrobial activity against Staphylococcus aureus biofilms (Turner et al., 2019)

Turner et al. evaluated the bactericidal activity of LL-37 against planktonic and biofilm-forming Staphylococcus aureus in a well-controlled in-vitro study. ^[13] The minimum inhibitory concentration (MIC) for planktonic S. aureus was determined to be 32 microM, consistent with previously published values, using standard broth microdilution according to CLSI guidelines. The study then tested a concentration series of 1.75, 2.5, 3.75, 5, 10, and 100 microM against established 24-hour biofilms using the colony-forming unit (CFU) reduction assay and live/dead fluorescence microscopy.

At 5 microM, LL-37 achieved a 1.5-log reduction in biofilm-associated CFU counts and disrupted biofilm architecture as visualized by confocal scanning laser microscopy. At 10 microM, a 3-log reduction was observed, representing 99.9% killing of viable cells within the biofilm matrix. At 100 microM, near-complete eradication was achieved, though this concentration exceeded cytotoxic thresholds for human erythrocytes, underscoring the therapeutic window challenge. Importantly, sub-MIC concentrations (1-2 microM) suppressed biofilm formation when added at the time of bacterial inoculation, suggesting a preventive application distinct from curative bactericidal use.

The study design did not include in-vivo infection models, limiting translation, but the concentration-response data provide a useful quantitative framework for researchers designing antimicrobial assays. The biofilm disruption activity likely involves both membrane destabilization and chelation of divalent cations (Ca²+, Mg²+) that stabilize biofilm exopolysaccharide matrices.

Study 3, Intestinal epithelial barrier repair (Tai et al., 2022)

A 2022 study by Tai and colleagues examined LL-37's role in maintaining and restoring intestinal epithelial barrier function, directly relevant to the gut-health research category. ^[12] Using Caco-2 monolayer cultures as a model of intestinal epithelium, the investigators measured transepithelial electrical resistance (TEER) and fluorescent tracer permeability following LL-37 treatment in the context of cytokine-induced barrier disruption (IFN-gamma plus TNF-alpha).

LL-37 at 0.5-1 microM significantly attenuated the TEER decline induced by the cytokine cocktail, and immunofluorescence staining showed preservation of ZO-1 and claudin-4 tight-junction localization at the apicolateral membrane. At concentrations above 5 microM, LL-37 itself caused mild TEER reduction, illustrating the dose-dependent biphasic behavior characteristic of the peptide's interaction with eukaryotic membranes. In a scratch-wound repair assay, 0.5 microM LL-37 accelerated wound closure by approximately 40% at 24 hours versus control, an effect that was partially blocked by EGFR inhibitor AG1478, implicating EGFR transactivation in the migratory response.

This study strengthens the preclinical rationale for LL-37 research in inflammatory bowel disease models; however, the Caco-2 system does not recapitulate the full complexity of the intestinal mucosa, which includes goblet cells, enteroendocrine cells, and the subepithelial lamina propria with its resident immune cells. Follow-on studies using organoid systems or in-vivo colitis models are needed to substantiate these findings.

Study 4, Antiviral activity against influenza A and SARS-CoV-2 Spike binding (Barlow et al., 2014; Saris et al., 2021)

Barlow et al. examined LL-37's direct antiviral activity against influenza A virus (IAV) using plaque reduction assays and transmission electron microscopy. ^[14] When LL-37 at concentrations of 10-100 microM was incubated with IAV prior to cell infection, plaque counts in MDCK cells were reduced by up to 90% compared to virus-alone controls. TEM imaging of LL-37-treated viral particles showed membrane degradation and loss of the characteristic hemagglutinin spike architecture, indicating direct virucidal activity through membrane disruption analogous to the bacterial mechanism. The peptide also reduced IAV replication when added after infection, though less potently, suggesting an additional mechanism involving interference with intracellular replication steps or immune signaling.

A complementary antiviral line of research was published by Saris and colleagues, who used surface plasmon resonance and pseudovirus neutralization assays to characterize LL-37's interaction with the SARS-CoV-2 Spike glycoprotein. ^[15] LL-37 bound the receptor-binding domain (RBD), the S1 ectodomain, and the S2 subunit with dissociation constants in the low-to-mid micromolar range. Binding stoichiometry estimated approximately six LL-37 molecules per Spike trimer, consistent with a halo-like distribution around the protein. At 25 microM, LL-37 reduced pseudovirus entry into ACE2-expressing HEK293T cells by approximately 60%, and native SARS-CoV-2 neutralization was observed in Vero cell assays at similar concentrations.

Both studies should be interpreted carefully in the context of the concentrations required: 10-100 microM substantially exceeds physiological tissue concentrations of LL-37 (typically 0.1-5 microM at sites of active infection), raising questions about whether direct virucidal activity is the dominant antiviral mechanism in vivo, or whether indirect immunomodulatory effects are more important.

Study 5, Modulation of P2X7 receptor and cell growth (Bhalla et al., 2008)

Bhalla and colleagues provided a mechanistic dissection of LL-37's growth-promoting activity via P2X7 receptor modulation, using cancer cell lines alongside normal epithelial cells to map the structure-activity relationships. ^[10] The authors demonstrated that LL-37 at 1-3 microM increased proliferation of HaCaT keratinocytes and A431 squamous carcinoma cells in a concentration-dependent manner, with the effect blocked by KN-62 (a P2X7 antagonist) and AZ10606120 (a selective P2X7 negative allosteric modulator).

Critically, growth promotion was absent in P2X7-deficient cell variants and was restored by stable P2X7 transfection, providing genetic evidence for receptor specificity. The all-D enantiomer of LL-37 retained full growth-promoting activity, ruling out a conventional ligand-receptor binding model dependent on chirality and suggesting that physical membrane perturbation by the amphipathic helix gates P2X7 channel activity. Scrambled peptide sequences of identical amino acid composition but lacking helical structure were inactive, confirming that three-dimensional amphipathic architecture is required.

These findings carry dual implications for healing research: LL-37 may accelerate re-epithelialization via P2X7-dependent keratinocyte proliferation, but the same mechanism has potential relevance to neoplastic growth promotion in epithelial cancers, an important caveat for experimental design. In-vitro proliferation assays with LL-37 in cancer cell lines should account for this P2X7-mediated pathway.

Pharmacokinetics

The pharmacokinetic profile of LL-37 in research contexts is characterized by rapid proteolytic degradation and limited systemic exposure after peripheral administration, properties that substantially influence experimental design choices.

In biological fluids, LL-37 is cleaved by matrix metalloproteinases (MMP-7, MMP-12), plasmin, and several elastases present in airway surface liquid and wound exudate, generating shorter fragments (including GF-17 and other N- and C-terminal truncations) that retain partial antimicrobial activity but exhibit altered receptor pharmacology. ^[5] The half-life of intact LL-37 in undiluted human serum at 37°C has been estimated at 15-30 minutes in several protease stability assays, though this figure varies with the concentration of protease inhibitors present in different biological matrices.

Subcutaneous and intraperitoneal routes have been used in rodent models, with tissue distribution studies showing rapid partitioning to sites of inflammation and injury, likely due to the peptide's affinity for the anionic extracellular matrix components (heparan sulfate, chondroitin sulfate). ^[16] Intranasal and aerosolized delivery has been explored for respiratory infection models, with studies reporting detectable peptide in bronchoalveolar lavage fluid for 1-2 hours post-administration.

Renal clearance represents the dominant elimination pathway for the intact peptide and its fragments, consistent with the general pharmacokinetics of small peptides below approximately 5 kDa. In prolonged in-vivo dosing studies with related cationic antimicrobial peptides, dose-related increases in serum creatinine have been observed at high doses, indicating that renal handling should be monitored in longer research protocols. ^[16]

The low oral bioavailability of LL-37 is a significant constraint for gut-health research models. Studies attempting to examine intestinal epithelial effects must use either local administration (intra-luminal injection, enema-based delivery in rodents, or direct basolateral application in cell culture) or encapsulation strategies that protect the peptide from gastric and pancreatic proteases. Several nanoparticle encapsulation strategies have been reported to extend the apparent half-life of LL-37 in gastrointestinal models by 3-5 fold, though none have been validated in human tissue equivalents. ^[12]

Purity and Verification

What a legitimate CoA should contain

A certificate of analysis for LL-37 from a credible research supplier should include, at minimum, four independent analytical results: reversed-phase high-performance liquid chromatography (RP-HPLC) purity expressed as area-under-curve percentage (acceptable threshold: at least 98%); mass spectrometry confirmation of the correct molecular ion (theoretical monoisotopic mass 4492.58 Da, with tolerance of ±0.5 Da by ESI-MS); amino acid analysis (AAA) confirming the correct residue composition; and endotoxin quantification (LAL assay) showing less than 1 EU/mg, which is critical for immunological assays where residual LPS would confound innate immune endpoint measurements. ^[7]

The RP-HPLC chromatogram should show a single dominant peak with retention time consistent with a 37-residue cationic peptide on a C18 or C8 column under standard acetonitrile/TFA gradient conditions, typically eluting between 30-45% organic phase. A shoulder or secondary peak accounting for more than 2% of total area should prompt rejection of the batch or direct inquiry to the supplier for explanation.

Independent verification approaches for researchers

For high-stakes experiments, independent verification is advisable even with a supplier-provided CoA. A practical workflow begins with reconstituting a small aliquot (0.1-0.2 mg) in water and submitting it to a core proteomics facility for electrospray or MALDI mass spectrometry. The observed molecular ion should match the theoretical value within instrument specifications. If the facility offers peptide sequencing by LC-MS/MS fragmentation, a full sequence confirmation adds the highest level of confidence.

Biological activity verification using a standardized antimicrobial assay provides a functional purity check complementary to analytical chemistry. A well-validated method is the broth microdilution MIC assay against Escherichia coli ATCC 25922 (a reference strain with established LL-37 sensitivity), where a confirmed MIC in the range of 2-8 microM indicates active, correctly folded peptide. ^[13] If the MIC is substantially higher than the literature range, oxidation of methionine residues, incorrect disulfide formation in modified analogs, or sequence errors should be investigated.

For immunological assays where LPS contamination is particularly problematic, the Limulus amebocyte lysate (LAL) test should be repeated on the reconstituted working solution rather than relying solely on the manufacturer's lyophilized-powder measurement, as contamination can occur during reconstitution with non-sterile water or equipment.

Our broader guide on reading and interpreting peptide certificates of analysis covers these verification steps in detail, including how to identify chromatographic artifacts and interpret mass spectrometry fragmentation patterns.

Dosage and Reconstitution

Reconstitution protocols used in published research

The majority of published studies reconstitute lyophilized LL-37 in sterile double-distilled water to a primary stock concentration of 1 mg/mL (approximately 222 microM). ^[3] For cell culture experiments requiring working concentrations in the sub-micromolar to low-micromolar range, further dilution is performed in the relevant cell culture medium immediately before use. Researchers should note that LL-37 binds to plastic surfaces (particularly polypropylene) and to serum albumin, both of which can reduce the effective free peptide concentration. Using siliconized tubes for stock aliquots and performing adsorption controls (measuring peptide concentration in buffer before and after incubation with experimental vessel materials) is recommended practice.

Where aqueous solubility is insufficient at the desired stock concentration, 0.1% acetic acid (approximately 17 mM) can be used as the primary solvent without altering peptide structure at the working dilution; concentrations above 1% acetic acid should be avoided as they may induce aggregation artifacts. Sonication at low power (10-20% amplitude, 5-10 seconds on ice) resolves aggregation at concentrations above 2 mg/mL if needed for high-dose experiments.

Worked numerical examples from the literature

Example 1, In-vitro antimicrobial MIC assay (5 mg vial). Starting from a 5 mg vial, dissolve the entire contents in 5 mL sterile water to obtain 1 mg/mL stock (approximately 222 microM). To prepare a 32 microM working solution for MIC testing in Mueller-Hinton broth, add 144 microL of stock to 856 microL broth (10x dilution from 1 mg/mL gives approximately 22.2 microM; from there, serial 2-fold dilutions cover the 0.5-32 microM range for a standard MIC panel). ^[13]

Example 2, In-vitro HUVEC tube formation assay. For FPR2-mediated angiogenesis assays, Koczulla et al. used 0.1-1 microM LL-37 in endothelial basal medium. From 1 mg/mL stock, prepare a 10 microM intermediate by diluting 45 microL stock into 955 microL medium, then prepare the final 1 microM working solution by adding 100 microL of the 10 microM intermediate to 900 microL medium. ^[3]

Example 3, Murine subcutaneous wound model. Published protocols for excisional wound studies in mice have used intra-wound injection volumes of 20 microL containing 10 micrograms LL-37 (equivalent to approximately 0.5 mg/kg for a 20 g mouse receiving this dose per wound). From a 1 mg/mL stock, 10 microL would be needed per injection; prepare fresh daily aliquots from -80°C stored stock to avoid degradation-related dose variability. ^[9]

The complete step-by-step reconstitution guide, including calculations for any vial size and target concentration, is available at /guides/how-to-reconstitute-peptides. Dosage mathematics for converting between mg/kg, microM, and microgram-per-well formats is covered at /guides/how-to-calculate-dosage.

Storage and stability guidance for reconstituted stocks

Reconstituted LL-37 at 1 mg/mL in sterile water is stable for 7 days at 4°C in a sealed microcentrifuge tube. For storage beyond one week, aliquot into single-use volumes and store at -80°C; stability under these conditions exceeds 12 months based on re-testing by RP-HPLC reported in several methodological papers. Avoid -20°C long-term storage as freeze-thaw cycling at this temperature has been associated with peptide aggregation; -80°C provides a more stable thermal environment. Lyophilized, unopened vials at -20°C in a desiccated environment are stable for 24 months or longer.

Side Effects and Safety

Cytotoxicity and hemolytic activity

The most consistently reported adverse effect in in-vitro studies is concentration-dependent cytotoxicity to mammalian cells. LL-37 at concentrations above 5-10 microM induces lysis of human erythrocytes (hemolysis), with HC50 values (concentration causing 50% hemolysis) reported between 10 and 100 microM across multiple studies depending on erythrocyte source and assay conditions. ^[5] The peptide also exhibits toxicity toward human leukocytes and T lymphocytes at similar concentrations, which complicates interpretation of high-dose immunological assays. For reference, the truncated fragment GF-17 achieves hemolysis below 1% at 18.75 micrograms/mL while retaining antimicrobial activity, illustrating the trade-offs achievable through structural modification.

Inflammatory paradox: pro- and anti-inflammatory dual roles

LL-37's immunological profile is concentration- and context-dependent in ways that create significant experimental hazards for misinterpretation. At low concentrations (0.1-1 microM), the peptide generally exerts anti-inflammatory effects through LPS neutralization and modulation of TLR signaling. At higher concentrations (5-20 microM) in the presence of self-DNA or RNA, LL-37 forms complexes that activate FPR2 and TLR9 (in pDCs), driving IFN-alpha production and promoting autoimmune-like inflammatory responses. ^[6] This dual behavior has been documented in psoriasis and lupus research, where LL-37-DNA complexes in skin lesions activate pDCs and sustain chronic inflammation. Researchers designing immunological experiments must specify and control the concentration range with this biphasic dose-response in mind.

Renal considerations in animal models

In extended rodent dosing studies using cationic antimicrobial peptides structurally related to LL-37, dose-dependent increases in serum creatinine and blood urea nitrogen (BUN) have been observed at high systemic doses, identifying the kidney as a potential organ of concern. ^[16] For in-vivo LL-37 protocols exceeding single acute dosing, baseline and endpoint measurement of renal biomarkers (creatinine, BUN, urinary casts) represents standard practice in responsible animal research.

Aggregation and batch-to-batch variability as experimental confounders

LL-37 has a strong tendency to aggregate in physiological salt solutions, particularly at concentrations above 5 microM, and aggregation state significantly influences biological activity. Aggregated LL-37 shows reduced FPR2-binding efficiency and altered membrane-interaction kinetics compared to monomeric peptide. ^[1] Researchers should validate peptide aggregation state using dynamic light scattering (DLS) or analytical size-exclusion chromatography when working above 5 microM in any salt-containing buffer.

Tumor-promoting potential in epithelial cancer contexts

The P2X7-mediated growth-promoting activity of LL-37 documented by Bhalla et al. raises a specific concern for in-vitro experiments using cancer cell lines. ^[10] Several independent studies have identified LL-37 as a growth factor for ovarian, lung, and gastric carcinoma cells in vitro, with tumor-derived LL-37 proposed as an autocrine survival signal. Researchers should be aware of this potential confound when interpreting proliferation and viability endpoints in cancer cell models.

How It Compares

LL-37 occupies a unique position in this comparison group by combining direct antimicrobial activity with multiple host-cell signaling functions. Its closest functional comparators in the context of healing research are BPC-157 and Thymosin beta-4, both of which promote tissue repair through growth factor pathways, but neither carries LL-37's direct antibacterial activity or LPS-neutralizing capacity. For researchers whose primary interest is wound healing in a contaminated or infection-present environment (such as a diabetic wound model), LL-37's dual antimicrobial and angiogenic functions may offer experimental advantages over single-function repair peptides.

Among the cathelicidin fragment library, GF-17 and KR-12 offer improved therapeutic index with lower hemolytic activity, which may be preferable for in-vitro experiments requiring concentrations above 5 microM. The full-length LL-37 5 mg vial reviewed here is most appropriate for research questions specifically requiring the complete FPR2-binding domain and native immunomodulatory profile.

For additional context on healing-category peptides, see our best peptides for healing roundup, and for gut-health applications, our best peptides for gut health guide covers the comparative evidence base in detail.

Where to Buy

Apollo Peptide Sciences lists LL-37 5mg at $45.00 per vial. At this price point, the 5 mg quantity provides sufficient material for a standard in-vitro experiment series: a full MIC panel across six bacterial strains consumes approximately 0.5 mg, leaving ample peptide for confirmatory assays, dose-response curves, and mechanistic follow-on experiments at sub-MIC concentrations.

Our full LL-37 5mg product page includes the most current CoA excerpts, batch-specific purity data, and direct links to Apollo Peptide Sciences' ordering portal. For a broader evaluation of supplier quality, cold-chain practices, and third-party testing policies, see our research peptide suppliers guide.

When selecting a supplier for LL-37, the most critical discriminating criteria are: (1) provision of batch-specific RP-HPLC chromatogram (not just a purity percentage), (2) mass spectrometry confirmation of the correct molecular ion, and (3) endotoxin testing showing LAL result below 1 EU/mg. Suppliers who provide only a certificate without supporting raw analytical data should be treated with caution. Our peptide supplier evaluation checklist provides a structured framework for this assessment.

FAQ

References